PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv3_061350_fahh.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family NF-YA
Protein Properties Length: 202aa    MW: 22543.8 Da    PI: 9.213
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv3_061350_fahh.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.21.1e-32128183258
           CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                         ep+YVNaKQy++Il+RRq+Rak+e e+++ +k+rkpylheSRh hA++R+RgsgGrF
  Bv3_061350_fahh.t1 128 EPIYVNAKQYHGILRRRQSRAKAELENRV-AKARKPYLHESRHLHAMKRARGSGGRF 183
                         8****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005219.6E-36125186IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.979126186IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.5E-29128183IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.1E-24129151IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860131151IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.1E-24160183IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MNQKAEQYFS SKSSSTSHSH SQVICWSDNF LNDPPSSSSY LSMECSSNLN YSFHEDSNNP  60
IVSLGKYGEQ PKQELQLGIF PMDHPQMIHE YHMPGSNQAG LSHHNTGYYE GMHSSGGVPL  120
PGEAANYEPI YVNAKQYHGI LRRRQSRAKA ELENRVAKAR KPYLHESRHL HAMKRARGSG  180
GRFLNTKKTD GPSSSNSSAQ SS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-23128192367NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010672780.11e-149PREDICTED: nuclear transcription factor Y subunit A-4-like isoform X1
TrEMBLA0A0J8CNV11e-149A0A0J8CNV1_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.17e-34nuclear factor Y, subunit A7